PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462910097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 459aa    MW: 52550.9 Da    PI: 6.372
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462910097genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-074094422154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp+++++++L +++gL+ +q+ +WF N+R +
  462910097 409 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 442
                469*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-152569IPR005540KNOX1
PfamPF037906.6E-142767IPR005540KNOX1
SMARTSM012561.7E-2380135IPR005541KNOX2
PfamPF037917.3E-1883134IPR005541KNOX2
SMARTSM012562.1E-13228295IPR005541KNOX2
Gene3DG3DSA:1.10.10.606.0E-7230259IPR009057Homeodomain-like
PfamPF037911.2E-11256294IPR005541KNOX2
PROSITE profilePS5007111.726383446IPR001356Homeobox domain
SMARTSM003891.8E-10385450IPR001356Homeobox domain
SuperFamilySSF466897.7E-16385449IPR009057Homeodomain-like
CDDcd000863.82E-11386447No hitNo description
Gene3DG3DSA:1.10.10.605.0E-25390449IPR009057Homeodomain-like
PfamPF059201.9E-17403442IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MQQQTPIPDA NRKVAAAAAE AEERQLLKGE IAVHPLCEQL VTAHVGCLRV ATPIDHLPLI  60
DAQLSQSSGL LHSYAAHHRP FLSPHDKHDL DSFLAQYLML LCSFREQLQQ HVRVHAVEAV  120
MACREIEQSL QDLTGATLEE GTGATMSEDE DEPPIMDGPM DMGSDAHDMM GFGPLLPTDS  180
ERSLMERVRQ ELKIELKQLI RRSFPFSSLQ GFKSRIEDVR EEILRKRRAG KLPGDTTSIL  240
KQWWQQHAKW PYPTAQYLML LCSFREQLQQ HVRVHAVEAV MACREIEQSL QDLTGATLEE  300
GTGATMSEDE DEPPIMDGPM DMGSDAHDMM GFGPLLPTDS ERSLMERVRQ ELKIELKQLI  360
RRSFPFSSLQ GFKSRIEDVR EEILRKRRAG KLPGDTTSIL KQWWQQHAKW PYPTEDDKAK  420
LVEETGLQLK QINNWFINQR KRNWHNNSQT STLKSKRKR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1439458RKRNWHNNSQTSTLKSKRKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9669070.0EU966907.1 Zea mays clone 298091 homeobox protein HD1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985913.11e-150PREDICTED: homeobox protein knotted-1-like 3
SwissprotQ94LW31e-148KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLK4ACX01e-150K4ACX0_SETIT; Uncharacterized protein
STRINGSi036727m1e-149(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-102KNOTTED-like homeobox of Arabidopsis thaliana 7